VPS16 Peptide - N-terminal region
VPS16 Peptide - N-terminal region
Product Specifications
Product Name Alternative
HVPS16
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with VPS16 Rabbit Polyclonal Antibody (orb330938) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_536339
Preservative
Lyophilized powder
AA Sequence
RGDFFMTLRNQPMALSLYRQFCKHQELETLKDLYNQDDNHQELGSFHIRA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![TRMT12 Mouse Monoclonal Antibody [Clone ID: OTI8C7]](https://cdn.genprice.uk/products/937/68dd18ba061270361e908631/imageurl/cf809550.webp)
CF809550 100 µg
TRMT12 Mouse Monoclonal Antibody [Clone ID: OTI8C7]
Sign In for Pricing
View Details ![KDM1A Mouse Monoclonal Antibody [Clone ID: 1B2-E5-G3]](https://cdn.genprice.uk/products/937/6868c2cf994c49e6dc3e7737/imageurl/ta384593.webp)
TA384593 100 µL
KDM1A Mouse Monoclonal Antibody [Clone ID: 1B2-E5-G3]
Sign In for Pricing
View Details 
BNCB0800-500 1x 500 µL
Cytokeratin 19 (KRT19/800), Biotin conjugate, 0.1mg/mL
Sign In for Pricing
View Details ![Bis[1-Hydroxypyridine-2(1H)-thionato-S,O]Copper(II)](https://cdn.genprice.uk/products/572/1959269310222/imageurl/trc-b703493-10mg.webp)
TRC-B703493-10MG 10 mg
Bis[1-Hydroxypyridine-2(1H)-thionato-S,O]Copper(II)
Sign In for Pricing
View Details