Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Vps36 Peptide - N-terminal region

Vps36 Peptide - N-terminal region

Product Specifications

Product Name Alternative

1700010A24Rik, 2210415M20Rik, 2810408E15Rik, Eap45

UniProt

Q91XD6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Vps36 Rabbit Polyclonal Antibody (orb330896) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_081614

Preservative

Lyophilized powder

AA Sequence

SNKEPGPFQSSKNSYIRLSFKEHGQIEFYRRLSEEMTQRRWETVPVSQSL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human MS4A14 activation kit by CRISPRa
GA113655 1 Kit

Human MS4A14 activation kit by CRISPRa

Sign In for Pricing
View Details
Assay Plates
DP35F-96-BLK-S-IWL 100 Units/Case

Assay Plates

Sign In for Pricing
View Details
SUV39H1 Human Gene Knockout Kit (CRISPR)
KN402428 1 Kit

SUV39H1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
1-Bromonaphthalene-d7
TRC-B685902-1G 1 g

1-Bromonaphthalene-d7

Sign In for Pricing
View Details
HABP2 Mouse Monoclonal Antibody [Clone ID: OTI2B5]
CF809360 100 µg

HABP2 Mouse Monoclonal Antibody [Clone ID: OTI2B5]

Sign In for Pricing
View Details
Human GTPBP8 activation kit by CRISPRa
GA109219 1 Kit

Human GTPBP8 activation kit by CRISPRa

Sign In for Pricing
View Details