Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Vps36 Peptide - N-terminal region

Vps36 Peptide - N-terminal region

Product Specifications

Product Name Alternative

1700010A24Rik, 2210415M20Rik, 2810408E15Rik, Eap45

UniProt

Q91XD6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Vps36 Rabbit Polyclonal Antibody (orb330896) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_081614

Preservative

Lyophilized powder

AA Sequence

SNKEPGPFQSSKNSYIRLSFKEHGQIEFYRRLSEEMTQRRWETVPVSQSL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZRANB3 (NM_001286568) Human Tagged ORF Clone
RG239944 10 µg

ZRANB3 (NM_001286568) Human Tagged ORF Clone

Sign In for Pricing
View Details
MAT2B (N-term) Rabbit Polyclonal Antibody
AP52614PU-N 400 µL

MAT2B (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
P44/42 MAPK Antibody
8C0185-AAT 50 µg

P44/42 MAPK Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung
CS809304 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
Human TMEM45B activation kit by CRISPRa
GA114712 1 Kit

Human TMEM45B activation kit by CRISPRa

Sign In for Pricing
View Details
ENTPD7 Polyclonal Antibody
E-AB-15205-01 20 µL

ENTPD7 Polyclonal Antibody

Sign In for Pricing
View Details