Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VPS52 Peptide - middle region

VPS52 Peptide - middle region

Product Specifications

Product Name Alternative

ARE1, DKFZp547I194, RP5-1033B10, SAC2, SACM2L, dJ1033B10.5

UniProt

Q8N1B4

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with VPS52 Rabbit Polyclonal Antibody (orb583650) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_072047

Preservative

Lyophilized powder

AA Sequence

RYWEQVLALLWPRFELILEMNVQSVRSTDPQRLGGLDTRPHYITRRYAEF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

hsa-miR-514a-5p miRNA Agomir
MBS8312570-01 5 nmol

hsa-miR-514a-5p miRNA Agomir

Sign In for Pricing
View Details
hsa-miR-514a-5p miRNA Agomir
MBS8312570-02 10 nmol

hsa-miR-514a-5p miRNA Agomir

Sign In for Pricing
View Details
hsa-miR-514a-5p miRNA Agomir
MBS8312570-03 20 nmol

hsa-miR-514a-5p miRNA Agomir

Sign In for Pricing
View Details
hsa-miR-514a-5p miRNA Agomir
MBS8312570-04 5x 20 nmol

hsa-miR-514a-5p miRNA Agomir

Sign In for Pricing
View Details
RHOA Protein Vector (Human) (pPB-C-His)
PV035177 500 ng

RHOA Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
KT3-Tag Mouse Monoclonal Antibody (HRP)
orb475120 100 µL

KT3-Tag Mouse Monoclonal Antibody (HRP)

Sign In for Pricing
View Details