Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VPS52 Peptide - middle region

VPS52 Peptide - middle region

Product Specifications

Product Name Alternative

ARE1, DKFZp547I194, RP5-1033B10, SAC2, SACM2L, dJ1033B10.5

UniProt

Q8N1B4

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with VPS52 Rabbit Polyclonal Antibody (orb583650) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_072047

Preservative

Lyophilized powder

AA Sequence

RYWEQVLALLWPRFELILEMNVQSVRSTDPQRLGGLDTRPHYITRRYAEF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PHB Antibody
CSB-PA017885LA01HU-01 50 µg

PHB Antibody

Sign In for Pricing
View Details
PHB Antibody
CSB-PA017885LA01HU-02 100 µg

PHB Antibody

Sign In for Pricing
View Details
Rat Gdpd4 Pre-designed siRNA Set A
SI205508A 1 Each

Rat Gdpd4 Pre-designed siRNA Set A

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to E-cadherin
MBS2113976-01 0.1 mL

FITC-Linked Polyclonal Antibody to E-cadherin

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to E-cadherin
MBS2113976-02 0.2 mL

FITC-Linked Polyclonal Antibody to E-cadherin

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to E-cadherin
MBS2113976-03 0.5 mL

FITC-Linked Polyclonal Antibody to E-cadherin

Sign In for Pricing
View Details