Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Vps72 Peptide - N-terminal region

Vps72 Peptide - N-terminal region

Product Specifications

Product Name Alternative

Tcfl1, YL-1

UniProt

Q62481

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Vps72 Rabbit Polyclonal Antibody (orb574615) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_033362

Preservative

Lyophilized powder

AA Sequence

AGGRAPRKTAGNRLSGLLEAEEEDEFYQTTYGGFTEESGDDEYQGDQSDT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RGD1565411 Protein Vector (Rat) (pPM-C-His)
PV301009 500 ng

RGD1565411 Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
SPOELLUCHT250X26CARD-T1-P8 Pipe Markers for Air & Ducts
N004792 4 Card (4 Marker (s) x 1 Card)

SPOELLUCHT250X26CARD-T1-P8 Pipe Markers for Air & Ducts

Sign In for Pricing
View Details
Rabbit Polyclonal PPP6C Antibody [PerCP]
NB100-2883PCP 0.1 mL

Rabbit Polyclonal PPP6C Antibody [PerCP]

Sign In for Pricing
View Details
LKB1/STK11 Rabbit Polyclonal Antibody (Fluoro488)
orb3078189 100 µg

LKB1/STK11 Rabbit Polyclonal Antibody (Fluoro488)

Sign In for Pricing
View Details
Anti-PNKP Antibody (5M822)
TMAB-11595-01 25 µL

Anti-PNKP Antibody (5M822)

Sign In for Pricing
View Details
Anti-PNKP Antibody (5M822)
TMAB-11595-02 50 μL

Anti-PNKP Antibody (5M822)

Sign In for Pricing
View Details