Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Vps72 Peptide - N-terminal region

Vps72 Peptide - N-terminal region

Product Specifications

Product Name Alternative

Tcfl1, YL-1

UniProt

Q62481

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Vps72 Rabbit Polyclonal Antibody (orb574615) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_033362

Preservative

Lyophilized powder

AA Sequence

AGGRAPRKTAGNRLSGLLEAEEEDEFYQTTYGGFTEESGDDEYQGDQSDT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Platelet Activating Factor Acetylhydrolase IB subunit beta ELISA Kit
MBS7275765-01 48 Well

Human Platelet Activating Factor Acetylhydrolase IB subunit beta ELISA Kit

Sign In for Pricing
View Details
Human Platelet Activating Factor Acetylhydrolase IB subunit beta ELISA Kit
MBS7275765-02 96 Well

Human Platelet Activating Factor Acetylhydrolase IB subunit beta ELISA Kit

Sign In for Pricing
View Details
Human Platelet Activating Factor Acetylhydrolase IB subunit beta ELISA Kit
MBS7275765-03 5x 96 Well

Human Platelet Activating Factor Acetylhydrolase IB subunit beta ELISA Kit

Sign In for Pricing
View Details
Human Platelet Activating Factor Acetylhydrolase IB subunit beta ELISA Kit
MBS7275765-04 10x 96 Well

Human Platelet Activating Factor Acetylhydrolase IB subunit beta ELISA Kit

Sign In for Pricing
View Details
Anti-Mbd4 Antibody Picoband
MBS1758396-01 0.01 mg

Anti-Mbd4 Antibody Picoband

Sign In for Pricing
View Details
Anti-Mbd4 Antibody Picoband
MBS1758396-02 0.1 mg (Carrier Free)

Anti-Mbd4 Antibody Picoband

Sign In for Pricing
View Details