WASL Peptide - middle region
WASL Peptide - middle region
Product Specifications
Product Name Alternative
DKFZp779G0847, MGC48327, N-WASP, NWASP
UniProt
O00401
Field of Research
Musculoskeletal & Connective Tissue Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with WASL Rabbit Polyclonal Antibody (orb585669) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_003932
Preservative
Lyophilized powder
AA Sequence
ISHTKEKKKGKAKKKRLTKADIGTPSNFQHIGHVGWDPNTGFDLNNLDPE
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
E-UNEL-H0066-01 5x 96 Tests
Uncoated Human ICAM-1/CD54 (intercellular adhesion molecule 1) ELISA Kit
Sign In for Pricing
View Details E-UNEL-H0066-02 15x 96 Tests
Uncoated Human ICAM-1/CD54 (intercellular adhesion molecule 1) ELISA Kit
Sign In for Pricing
View Details 
BNC400144-500 1x 500 µL
Borrelia burgdorferi (p41 Flagellin) (6802), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC742176-500 1x 500 µL
MMP9 (rMMP9/1769), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400713-500 1x 500 µL
MyoD1 (5.8A + MYD712), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC401888-100 1x 100 µL
CD1a / HTA1 (Mature Langerhans Cells Marker) (rC1A/711), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details