Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

WASL Peptide - middle region

WASL Peptide - middle region

Product Specifications

Product Name Alternative

DKFZp779G0847, MGC48327, N-WASP, NWASP

UniProt

O00401

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with WASL Rabbit Polyclonal Antibody (orb585669) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003932

Preservative

Lyophilized powder

AA Sequence

ISHTKEKKKGKAKKKRLTKADIGTPSNFQHIGHVGWDPNTGFDLNNLDPE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human IL-15 R alpha / CD215 Protein, Fc Tag (MALS verified)
ILA-H5253-100ug 100 µg

Human IL-15 R alpha / CD215 Protein, Fc Tag (MALS verified)

Sign In for Pricing
View Details
(S)-(+)-Canadaline-d3
TRC-C175187-5MG 5 mg

(S)-(+)-Canadaline-d3

Sign In for Pricing
View Details
Nisin Z (~80%) Hydrochloride
TRC-N487558-5MG 5 mg

Nisin Z (~80%) Hydrochloride

Sign In for Pricing
View Details
RPS4Y2 (NM_001039567) Human Over-expression Lysate
LC422071 20 µg

RPS4Y2 (NM_001039567) Human Over-expression Lysate

Sign In for Pricing
View Details
Tissue FFPE Sections, Renal pelvis
CS710409 5x 5 µm

Tissue FFPE Sections, Renal pelvis

Sign In for Pricing
View Details
SERPINB2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1F6]
TA503928AM 100 µL

SERPINB2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1F6]

Sign In for Pricing
View Details