Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TCEAL9 Peptide - middle region

TCEAL9 Peptide - middle region

Product Specifications

Product Name Alternative

WBP5, WEX6

UniProt

Q9UHQ7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TCEAL9 Rabbit Polyclonal Antibody (orb324788) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_057387

Preservative

Lyophilized powder

AA Sequence

TFRERLIQSLQEFKEDIHNRHLSNEDMFREVDEIDEIRRVRNKLIVMRWK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human/Mouse/Rat Irisin/FNDC5 (N-6His)
PKSM041407-01 10 µg

Recombinant Human/Mouse/Rat Irisin/FNDC5 (N-6His)

Sign In for Pricing
View Details
Recombinant Human/Mouse/Rat Irisin/FNDC5 (N-6His)
PKSM041407-02 50 µg

Recombinant Human/Mouse/Rat Irisin/FNDC5 (N-6His)

Sign In for Pricing
View Details
Biotin Anti-Mouse IgD Antibody[11-26c.2a]
E-AB-F1189B-01 25 µg

Biotin Anti-Mouse IgD Antibody[11-26c.2a]

Sign In for Pricing
View Details
Biotin Anti-Mouse IgD Antibody[11-26c.2a]
E-AB-F1189B-02 100 µg

Biotin Anti-Mouse IgD Antibody[11-26c.2a]

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon: sigmoid
CS622947 5x 5 µm

Frozen Tissue Sections, Colon: sigmoid

Sign In for Pricing
View Details
Mouse Angiopoietin Like Protein 8 (ANGPTL8) ELISA Kit
RDR-ANGPTL8-Mu-01 96 Tests

Mouse Angiopoietin Like Protein 8 (ANGPTL8) ELISA Kit

Sign In for Pricing
View Details