Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TCEAL9 Peptide - middle region

TCEAL9 Peptide - middle region

Product Specifications

Product Name Alternative

WBP5, WEX6

UniProt

Q9UHQ7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TCEAL9 Rabbit Polyclonal Antibody (orb324788) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_057387

Preservative

Lyophilized powder

AA Sequence

TFRERLIQSLQEFKEDIHNRHLSNEDMFREVDEIDEIRRVRNKLIVMRWK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

XRCC1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2D8]
TA500886AM 100 µL

XRCC1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2D8]

Sign In for Pricing
View Details
FOXS1 (NM_004118) Human Over-expression Lysate
LY418193 100 µg

FOXS1 (NM_004118) Human Over-expression Lysate

Sign In for Pricing
View Details
PPP5C Antibody
KC-6091-01 50 μL

PPP5C Antibody

Sign In for Pricing
View Details
PPP5C Antibody
KC-6091-02 100 µL

PPP5C Antibody

Sign In for Pricing
View Details
PPP5C Antibody
KC-6091-03 1 mL

PPP5C Antibody

Sign In for Pricing
View Details
Ethyl (3alpha,5beta,6alpha,7alpha)-6-Ethyl-3,7-dihydroxycholan-24-oate
TRC-E284840-500MG 500 mg

Ethyl (3alpha,5beta,6alpha,7alpha)-6-Ethyl-3,7-dihydroxycholan-24-oate

Sign In for Pricing
View Details