Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Wdfy1 Peptide - N-terminal region

Wdfy1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

1700013B03Rik, 1700120F24Rik, FENS-1, Jr1, KIAA1435, WDF1, ZFYVE17, mKIAA1435

UniProt

Q9DAD3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Wdfy1 Rabbit Polyclonal Antibody (orb583576) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_081333

Preservative

Lyophilized powder

AA Sequence

ASEDRTIRVWLKRDSGQYWPSIYHTMASPCSAMAYHHDSRRIFVGQDNGA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NRG1 (Center) Rabbit Polyclonal Antibody
AP13195PU-N 400 µL

NRG1 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Colloidal Gold Conjugated Monoclonal Antibody to Human IgA1,  5nm
GM-105-5 1 mL

Colloidal Gold Conjugated Monoclonal Antibody to Human IgA1, 5nm

Sign In for Pricing
View Details
Propyl 4-Hydroxybenzoate(Propyl Paraben)
TRC-P838285-1G 1 g

Propyl 4-Hydroxybenzoate(Propyl Paraben)

Sign In for Pricing
View Details
Tbx1 Mouse Gene Knockout Kit (CRISPR)
KN517283 1 Kit

Tbx1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
N-Isopropylcyclohexylamine
TRC-I824455-5G 5 g

N-Isopropylcyclohexylamine

Sign In for Pricing
View Details
Flugestone 17-Acetate
TRC-F489650-25MG 25 mg

Flugestone 17-Acetate

Sign In for Pricing
View Details