Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Wdfy1 Peptide - N-terminal region

Wdfy1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

1700013B03Rik, 1700120F24Rik, FENS-1, Jr1, KIAA1435, WDF1, ZFYVE17, mKIAA1435

UniProt

Q9DAD3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Wdfy1 Rabbit Polyclonal Antibody (orb583576) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_081333

Preservative

Lyophilized powder

AA Sequence

ASEDRTIRVWLKRDSGQYWPSIYHTMASPCSAMAYHHDSRRIFVGQDNGA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Lung
CS504155 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Human CD5 Antibody[5D7]
E-AB-F1371M1-01 20 Tests

Elab Fluor® 700 Anti-Human CD5 Antibody[5D7]

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Human CD5 Antibody[5D7]
E-AB-F1371M1-02 100 Tests

Elab Fluor® 700 Anti-Human CD5 Antibody[5D7]

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Human CD5 Antibody[5D7]
E-AB-F1371M1-03 2x 100 Tests

Elab Fluor® 700 Anti-Human CD5 Antibody[5D7]

Sign In for Pricing
View Details
1,2-Dideoxy-1-(phenylimino)-D-erythro-pentitol
TRC-D136240-100MG 100 mg

1,2-Dideoxy-1-(phenylimino)-D-erythro-pentitol

Sign In for Pricing
View Details
Alkaline Phosphatase Conjugated Rabbit Anti-HPA Antibody
AAL-3601-1 1 mL

Alkaline Phosphatase Conjugated Rabbit Anti-HPA Antibody

Sign In for Pricing
View Details