Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

WDFY1 Peptide - N-terminal region

WDFY1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

FENS-1, WDF1, ZFYVE17

UniProt

Q8IWB7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with WDFY1 Rabbit Polyclonal Antibody (orb583575) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_065881

Preservative

Lyophilized powder

AA Sequence

MAAEIHSRPQSSRPVLLSKIEGHQDAVTAALLIPKEDGVITASEDRTIRV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD66 (CEA) (C66/195), CF488A conjugate, 0.1mg/mL
BNC880195-100 1x 100 µL

CD66 (CEA) (C66/195), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Low-Density Lipoprotein Cholesterol (LDL-C) Colorimetric Assay Kit (Double Reagents)
E-BC-K205-S-01 50 Assays (46 samples)

Low-Density Lipoprotein Cholesterol (LDL-C) Colorimetric Assay Kit (Double Reagents)

Sign In for Pricing
View Details
Low-Density Lipoprotein Cholesterol (LDL-C) Colorimetric Assay Kit (Double Reagents)
E-BC-K205-S-02 100 Assays (96 samples)

Low-Density Lipoprotein Cholesterol (LDL-C) Colorimetric Assay Kit (Double Reagents)

Sign In for Pricing
View Details
ARID3C (NM_001017363) Human Over-expression Lysate
LC422637 20 µg

ARID3C (NM_001017363) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant CREB1 Antibody
RC-5146-01 50 μL

Recombinant CREB1 Antibody

Sign In for Pricing
View Details
Recombinant CREB1 Antibody
RC-5146-02 100 µL

Recombinant CREB1 Antibody

Sign In for Pricing
View Details