Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

WDFY1 Peptide - N-terminal region

WDFY1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

FENS-1, WDF1, ZFYVE17

UniProt

Q8IWB7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with WDFY1 Rabbit Polyclonal Antibody (orb583575) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_065881

Preservative

Lyophilized powder

AA Sequence

MAAEIHSRPQSSRPVLLSKIEGHQDAVTAALLIPKEDGVITASEDRTIRV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TentaGel® MAP 8 branch
J2004.1G 1 g

TentaGel® MAP 8 branch

Sign In for Pricing
View Details
Cks1b Mouse Gene Knockout Kit (CRISPR)
KN503378 1 Kit

Cks1b Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MYLK4 (NM_001012418) Human Over-expression Lysate
LC422856 20 µg

MYLK4 (NM_001012418) Human Over-expression Lysate

Sign In for Pricing
View Details
Dog IgG F(c) Antibody Peroxidase Conjugated
TA397618 2 mg

Dog IgG F(c) Antibody Peroxidase Conjugated

Sign In for Pricing
View Details
GPR25 Human Gene Knockout Kit (CRISPR)
KN423985 1 Kit

GPR25 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Cdc20 (AR12), Biotin conjugate, 0.1mg/mL
BNCB0672-500 1x 500 µL

Cdc20 (AR12), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details