Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Wdr12 Peptide - middle region

Wdr12 Peptide - middle region

Product Specifications

Product Name Alternative

4933402C23Rik, Ytm1, Ytm1p

UniProt

Q9JJA4

Field of Research

Cancer Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Wdr12 Rabbit Polyclonal Antibody (orb578001) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_067287

Preservative

Lyophilized powder

AA Sequence

SGAKFCSGSWDKMLKIWSTVPTDEEDEMEEATNRPRKKQKTEQLGLTRTP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PKCα Protein
UA080115-01 10 µg

PKCα Protein

Sign In for Pricing
View Details
PKCα Protein
UA080115-02 100 µg

PKCα Protein

Sign In for Pricing
View Details
ENO3 Polyclonal Antibody, PE-Cy5 Conjugated
bs-3979R-PE-Cy5 100 µL

ENO3 Polyclonal Antibody, PE-Cy5 Conjugated

Sign In for Pricing
View Details
CCDC64 Polyclonal Antibody
bs-13808R 100 µL

CCDC64 Polyclonal Antibody

Sign In for Pricing
View Details
IL17RC
CSB-CL818746HU 10 μg Plasmid + 200 μL Glycerol

IL17RC

Sign In for Pricing
View Details
Integrin alpha-M
AP83885-01 50 µg

Integrin alpha-M

Sign In for Pricing
View Details