Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

WDR33 Peptide - N-terminal region

WDR33 Peptide - N-terminal region

Product Specifications

Product Name Alternative

FLJ11294, WDC146, NET14

UniProt

Q9NUL1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with WDR33 Rabbit Polyclonal Antibody (orb325162) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001006623

Preservative

Lyophilized powder

AA Sequence

IWQRDQRDMRAIQPDAGYYNDLVPPIGMLNNPMNAVTTKFVRTSTNKVKC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 10 (KRT10) (Suprabasal Epithelial Marker) (rKRT10/844), CF488A conjugate, 0.1mg/mL
BNC881989-500 1x 500 µL

Cytokeratin 10 (KRT10) (Suprabasal Epithelial Marker) (rKRT10/844), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
BMP8B Mouse Monoclonal Antibody [Clone ID: AT13E6]
AM50356PU-S 50 µL

BMP8B Mouse Monoclonal Antibody [Clone ID: AT13E6]

Sign In for Pricing
View Details
4-Hydroxybenzoyl Chloride
TRC-H408125-500MG 500 mg

4-Hydroxybenzoyl Chloride

Sign In for Pricing
View Details
RAB38 Antibody
8C18248-AAT 50 µg

RAB38 Antibody

Sign In for Pricing
View Details
p-Nitrophenyl Iodoacetate
TRC-N503775-5G 5 g

p-Nitrophenyl Iodoacetate

Sign In for Pricing
View Details
CA4 Antibody
KC-8180-01 50 μL

CA4 Antibody

Sign In for Pricing
View Details