Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

WDR35 Peptide - N-terminal region

WDR35 Peptide - N-terminal region

Product Specifications

Product Name Alternative

KIAA1336, MGC33196, CED2

UniProt

Q9P2L0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with WDR35 Rabbit Polyclonal Antibody (orb583570) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_065830

Preservative

Lyophilized powder

AA Sequence

SGSVQVVTWNEQYQKLTTSDENGLIIVWMLYKGSWIEEMINNRNKSVVRS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hepatitis B Virus (HBV) TaqMan PCR Lyophilized Kits
TM29250L 100 Reactions

Hepatitis B Virus (HBV) TaqMan PCR Lyophilized Kits

Sign In for Pricing
View Details
ICI 63197
TRC-I163888-5MG 5 mg

ICI 63197

Sign In for Pricing
View Details
SMPD3 Antibody
KC-3999-01 50 μL

SMPD3 Antibody

Sign In for Pricing
View Details
SMPD3 Antibody
KC-3999-02 100 µL

SMPD3 Antibody

Sign In for Pricing
View Details
SMPD3 Antibody
KC-3999-03 1 mL

SMPD3 Antibody

Sign In for Pricing
View Details
1,2,3,4,6,7,8-Heptachlorodibenzofuran
TRC-H265080-1MG 1 mg

1,2,3,4,6,7,8-Heptachlorodibenzofuran

Sign In for Pricing
View Details