Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

WDR35 Peptide - N-terminal region

WDR35 Peptide - N-terminal region

Product Specifications

Product Name Alternative

KIAA1336, MGC33196, CED2

UniProt

Q9P2L0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with WDR35 Rabbit Polyclonal Antibody (orb583570) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_065830

Preservative

Lyophilized powder

AA Sequence

SGSVQVVTWNEQYQKLTTSDENGLIIVWMLYKGSWIEEMINNRNKSVVRS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Lung
CS500186 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
ATP5PD (NM_006356) Human Recombinant Protein
TP307908L 1 mg

ATP5PD (NM_006356) Human Recombinant Protein

Sign In for Pricing
View Details
Acetic Acid-d4
TRC-A167657-5G 5 g

Acetic Acid-d4

Sign In for Pricing
View Details
GSTA1 Antibody
KC-387-01 50 μL

GSTA1 Antibody

Sign In for Pricing
View Details
GSTA1 Antibody
KC-387-02 100 µL

GSTA1 Antibody

Sign In for Pricing
View Details
GSTA1 Antibody
KC-387-03 1 mL

GSTA1 Antibody

Sign In for Pricing
View Details