Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Wdr41 Peptide - middle region

Wdr41 Peptide - middle region

Product Specifications

Product Name Alternative

B830029I03Rik, MSTP048

UniProt

Q3UDP0

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Wdr41 Rabbit Polyclonal Antibody (orb583479) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_766178

Preservative

Lyophilized powder

AA Sequence

LVTPTEELPEWDIIEVKRLLDHQDNILSLANINDTGFVTGSHVGELLIWD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AGXT2 Double Nickase Plasmid (h)
sc-413054-NIC 20 µg

AGXT2 Double Nickase Plasmid (h)

Sign In for Pricing
View Details
SREBP2 Rabbit Polyclonal Antibody (BF488)
orb1604707 100 µL

SREBP2 Rabbit Polyclonal Antibody (BF488)

Sign In for Pricing
View Details
NL-1
BA3613-25 25 mg

NL-1

Sign In for Pricing
View Details
CD5 antibody
5CFB-100T 100 Tests

CD5 antibody

Sign In for Pricing
View Details
Phospho-TAK1 (Ser439) Antibody
MBS9600745-01 0.1 mL

Phospho-TAK1 (Ser439) Antibody

Sign In for Pricing
View Details
Phospho-TAK1 (Ser439) Antibody
MBS9600745-02 0.2 mL

Phospho-TAK1 (Ser439) Antibody

Sign In for Pricing
View Details