Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

WDR49 Peptide - N-terminal region

WDR49 Peptide - N-terminal region

Product Specifications

Product Name Alternative

FLJ33620

UniProt

Q8IV35

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with WDR49 Rabbit Polyclonal Antibody (orb582051) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_849146

Preservative

Lyophilized powder

AA Sequence

SQDFRCLFHFDEAHGRLFISFNNQLALLAMKSEASKRVKSHEKAVTCVLY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Clostridium Botulinum ackA Protein (aa 1-397) (strain Kyoto / Type A2)
VAng-Lsx7916-50gEcoli 50 µg (E. coli)

Recombinant Clostridium Botulinum ackA Protein (aa 1-397) (strain Kyoto / Type A2)

Sign In for Pricing
View Details
EGLN1 (NM_022051) Human Tagged Lenti ORF Clone
RC215158L1 10 µg

EGLN1 (NM_022051) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Mouse Monoclonal Filaggrin Antibody (FLG/1945) [DyLight 350]
NBP3-08355UV 100 µL

Mouse Monoclonal Filaggrin Antibody (FLG/1945) [DyLight 350]

Sign In for Pricing
View Details
MEK-4 discontinued
538907-01 30ul

MEK-4 discontinued

Sign In for Pricing
View Details
MEK-4 discontinued
538907-02 100 µL

MEK-4 discontinued

Sign In for Pricing
View Details
DLC-1 (h) : 293T Lysate
sc-116333 100 µg - 200 µL

DLC-1 (h) : 293T Lysate

Sign In for Pricing
View Details