Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Wdr5 Peptide - C-terminal region

Wdr5 Peptide - C-terminal region

Product Specifications

Product Name Alternative

2410008O07Rik, AA408785, AA960360, Big, Big-3

UniProt

P61965

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Wdr5 Rabbit Polyclonal Antibody (orb577999) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_543124

Preservative

Lyophilized powder

AA Sequence

NFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTEN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gα 11 shRNA (r) Lentiviral Particles
sc-45999-V 200 µL

Gα 11 shRNA (r) Lentiviral Particles

Sign In for Pricing
View Details
MC5R Antibody
MBS8516585-01 0.1 mg

MC5R Antibody

Sign In for Pricing
View Details
MC5R Antibody
MBS8516585-02 0.1 mL (AF635)

MC5R Antibody

Sign In for Pricing
View Details
MC5R Antibody
MBS8516585-03 0.1 mL (AF610)

MC5R Antibody

Sign In for Pricing
View Details
MC5R Antibody
MBS8516585-04 0.1 mL (AF405S)

MC5R Antibody

Sign In for Pricing
View Details
MC5R Antibody
MBS8516585-05 0.1 mL (AF405L)

MC5R Antibody

Sign In for Pricing
View Details