Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Wdr5 Peptide - C-terminal region

Wdr5 Peptide - C-terminal region

Product Specifications

Product Name Alternative

2410008O07Rik, AA408785, AA960360, Big, Big-3

UniProt

P61965

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Wdr5 Rabbit Polyclonal Antibody (orb577999) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_543124

Preservative

Lyophilized powder

AA Sequence

NFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTEN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human beta I Tubulin Protein - (Dry Ice)
H00081027-P01-25ug 25 µg

Recombinant Human beta I Tubulin Protein - (Dry Ice)

Sign In for Pricing
View Details
INSM1 Antibody-middle region
MBS3249846-01 0.1 mL

INSM1 Antibody-middle region

Sign In for Pricing
View Details
INSM1 Antibody-middle region
MBS3249846-02 5x 0.1 mL

INSM1 Antibody-middle region

Sign In for Pricing
View Details
Domoic Acid (Amnesic Shellfish Poisoning, PSP) discontinued
298168 20 µL

Domoic Acid (Amnesic Shellfish Poisoning, PSP) discontinued

Sign In for Pricing
View Details
Cd200r2 Mouse shRNA Lentiviral Particle (Locus ID 271375)
TL508131V 500 µL Each

Cd200r2 Mouse shRNA Lentiviral Particle (Locus ID 271375)

Sign In for Pricing
View Details
KALRN (NM_007064) Human Over-expression Lysate
LS008997-20ug 20 µg

KALRN (NM_007064) Human Over-expression Lysate

Sign In for Pricing
View Details