Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

WDR54 Peptide - middle region

WDR54 Peptide - middle region

Product Specifications

Product Name Alternative

FLJ12953

UniProt

Q9H977

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with WDR54 Rabbit Polyclonal Antibody (orb584710) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_115494

Preservative

Lyophilized powder

AA Sequence

NIVLSEELAGHQMPITDIATEPAQGQDCVADMVTADDSGLLCVWRSGPEF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARMC8 siRNA (Human)
CRH8544-01 15 nmol

ARMC8 siRNA (Human)

Sign In for Pricing
View Details
ARMC8 siRNA (Human)
CRH8544-02 30 nmol

ARMC8 siRNA (Human)

Sign In for Pricing
View Details
Anti Mouse CD183/CXCR3 Flow Cytometry Monoclonal Clone CXCR3173 AF488 Ready To Use 200 Tests
IHMAAMSCD183CXCR3173CAF488200 200 Tests

Anti Mouse CD183/CXCR3 Flow Cytometry Monoclonal Clone CXCR3173 AF488 Ready To Use 200 Tests

Sign In for Pricing
View Details
Mouse Pulmonary Surfactant-Associated Protein D (SFTPD) CLIA Kit
abx492349-01 96 Tests

Mouse Pulmonary Surfactant-Associated Protein D (SFTPD) CLIA Kit

Sign In for Pricing
View Details
Mouse Pulmonary Surfactant-Associated Protein D (SFTPD) CLIA Kit
abx492349-02 5x 96 Tests

Mouse Pulmonary Surfactant-Associated Protein D (SFTPD) CLIA Kit

Sign In for Pricing
View Details
Mouse Pulmonary Surfactant-Associated Protein D (SFTPD) CLIA Kit
abx492349-03 10x 96 Tests

Mouse Pulmonary Surfactant-Associated Protein D (SFTPD) CLIA Kit

Sign In for Pricing
View Details