Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

WDR54 Peptide - middle region

WDR54 Peptide - middle region

Product Specifications

Product Name Alternative

FLJ12953

UniProt

Q9H977

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with WDR54 Rabbit Polyclonal Antibody (orb584710) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_115494

Preservative

Lyophilized powder

AA Sequence

NIVLSEELAGHQMPITDIATEPAQGQDCVADMVTADDSGLLCVWRSGPEF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TIM 1 (HAVCR1) Human Recombinant Protein
TP724698 50 µg

TIM 1 (HAVCR1) Human Recombinant Protein

Sign In for Pricing
View Details
AIDA Antibody - C-terminal region
OAAB13058-400UL 400 µL

AIDA Antibody - C-terminal region

Sign In for Pricing
View Details
Sh3bgrl2 ORF Vector (Rat) (pORF)
ORF076180 1.0 µg DNA

Sh3bgrl2 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
Mouse Protocadherin 19 (PCDH19) ELISA Kit
MBS9939340-01 48 Well

Mouse Protocadherin 19 (PCDH19) ELISA Kit

Sign In for Pricing
View Details
Mouse Protocadherin 19 (PCDH19) ELISA Kit
MBS9939340-02 96 Well

Mouse Protocadherin 19 (PCDH19) ELISA Kit

Sign In for Pricing
View Details
Mouse Protocadherin 19 (PCDH19) ELISA Kit
MBS9939340-03 5x 96 Well

Mouse Protocadherin 19 (PCDH19) ELISA Kit

Sign In for Pricing
View Details