Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

WDR54 Peptide - C-terminal region

WDR54 Peptide - C-terminal region

Product Specifications

Product Name Alternative

FLJ12953

UniProt

Q9H977

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with WDR54 Rabbit Polyclonal Antibody (orb584711) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_115494

Preservative

Lyophilized powder

AA Sequence

HVQINAHARAICALDLASEVGKLLSAGEDTFVHIWKLSRNPESGYIEVEH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OR7E5P Antibody
8G732-AAT 50 µg

OR7E5P Antibody

Sign In for Pricing
View Details
PAX6 Mouse Monoclonal Antibody [Clone ID: PAX6/496]
AM50305PU-T 20 µg

PAX6 Mouse Monoclonal Antibody [Clone ID: PAX6/496]

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS501938 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
2-Fluorobenzal Chloride
TRC-F125600-1G 1 g

2-Fluorobenzal Chloride

Sign In for Pricing
View Details
HDAC3 Antibody
8C0224-AAT 50 µg

HDAC3 Antibody

Sign In for Pricing
View Details
SHANK2 Antibody
8C18711-AAT 50 µg

SHANK2 Antibody

Sign In for Pricing
View Details