Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

WDR74 Peptide - C-terminal region

WDR74 Peptide - C-terminal region

Product Specifications

Product Name Alternative

FLJ10439, FLJ21730

UniProt

Q6RFH5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with WDR74 Rabbit Polyclonal Antibody (orb585479) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060563

Preservative

Lyophilized powder

AA Sequence

PNKVPLEDTETDELWASLEAAAKRKLSGLEQPQGALQTRRRKKKRPGSTS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human von Willebrand Factor antigen ELISA Kit
ELA-E1958h 96 Tests

Human von Willebrand Factor antigen ELISA Kit

Sign In for Pricing
View Details
Anti-Phospholipase A2/PLA2G4A Antibody Picoband® Fluoro488 Conjugated
PA2047-Fluoro488 100 µg/Vial

Anti-Phospholipase A2/PLA2G4A Antibody Picoband® Fluoro488 Conjugated

Sign In for Pricing
View Details
ZNF264 Mouse Monoclonal Antibody [Clone ID: LBI6F3]
AMM19646VCF 100 µg

ZNF264 Mouse Monoclonal Antibody [Clone ID: LBI6F3]

Sign In for Pricing
View Details
Interferon Regulatory Factor 8 (IRF8, ICSBP1, Interferon Consensus Sequence Binding Protein 1, HGNC5358, MYLS) (APC) discontinued
I7662-93D-APC 100 µL

Interferon Regulatory Factor 8 (IRF8, ICSBP1, Interferon Consensus Sequence Binding Protein 1, HGNC5358, MYLS) (APC) discontinued

Sign In for Pricing
View Details
Recombinant Human CRNN Protein, N-His
AP95705 50 µg

Recombinant Human CRNN Protein, N-His

Sign In for Pricing
View Details
Insulin Like Growth Factor Binding Protein 6 (IGFBP6) BioAssayTM ELISA Kit (Human)
366170-01 48 Tests

Insulin Like Growth Factor Binding Protein 6 (IGFBP6) BioAssayTM ELISA Kit (Human)

Sign In for Pricing
View Details