Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

WDR74 Peptide - C-terminal region

WDR74 Peptide - C-terminal region

Product Specifications

Product Name Alternative

FLJ10439, FLJ21730

UniProt

Q6RFH5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with WDR74 Rabbit Polyclonal Antibody (orb585479) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060563

Preservative

Lyophilized powder

AA Sequence

PNKVPLEDTETDELWASLEAAAKRKLSGLEQPQGALQTRRRKKKRPGSTS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LAT Rabbit Polyclonal Antibody (APC-Cy7)
orb2554606 100 µL

LAT Rabbit Polyclonal Antibody (APC-Cy7)

Sign In for Pricing
View Details
ADCY6 Recombinant Protein
OPCD01121-10UG 10 µg

ADCY6 Recombinant Protein

Sign In for Pricing
View Details
MPK5 Antibody
orb838037 2 mg

MPK5 Antibody

Sign In for Pricing
View Details
Rabbit RNA Polymerase II, Phospho (S5) Antibody
orb1523051-01 10 µL

Rabbit RNA Polymerase II, Phospho (S5) Antibody

Sign In for Pricing
View Details
Rabbit RNA Polymerase II, Phospho (S5) Antibody
orb1523051-02 100 µL

Rabbit RNA Polymerase II, Phospho (S5) Antibody

Sign In for Pricing
View Details
Human Vasopressin-neurophysin 2-copeptin (AVP) ELISA Kit
abx253828 96 Well

Human Vasopressin-neurophysin 2-copeptin (AVP) ELISA Kit

Sign In for Pricing
View Details