Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Wdr8 Peptide - N-terminal region

Wdr8 Peptide - N-terminal region

Product Specifications

Product Name Alternative

2610044M17Rik, 5330425N03Rik, Dd57, Wrap73, Wdr8

UniProt

Q9JM98

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Wdr8 Rabbit Polyclonal Antibody (orb324949) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_067474

Preservative

Lyophilized powder

AA Sequence

RYLALAERRDCRDYVSIFVCSDWQLLRHFDTDTQDLTGIEWAPNGCVLAA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GCC1 (NM_024523) Human Recombinant Protein
TP304339M 100 µg

GCC1 (NM_024523) Human Recombinant Protein

Sign In for Pricing
View Details
Fertirelin Acetate
TRC-F309505-5MG 5 mg

Fertirelin Acetate

Sign In for Pricing
View Details
C10orf63 (ENKUR) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5D4]
TA804184AM 100 µL

C10orf63 (ENKUR) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5D4]

Sign In for Pricing
View Details
FCGR2B Antibody
KC-3912-01 50 μL

FCGR2B Antibody

Sign In for Pricing
View Details
FCGR2B Antibody
KC-3912-02 100 µL

FCGR2B Antibody

Sign In for Pricing
View Details
FCGR2B Antibody
KC-3912-03 1 mL

FCGR2B Antibody

Sign In for Pricing
View Details