Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Wdr8 Peptide - N-terminal region

Wdr8 Peptide - N-terminal region

Product Specifications

Product Name Alternative

2610044M17Rik, 5330425N03Rik, Dd57, Wrap73, Wdr8

UniProt

Q9JM98

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Wdr8 Rabbit Polyclonal Antibody (orb324949) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_067474

Preservative

Lyophilized powder

AA Sequence

RYLALAERRDCRDYVSIFVCSDWQLLRHFDTDTQDLTGIEWAPNGCVLAA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RAB34 Rabbit Polyclonal Antibody
TA380629 100 µL

RAB34 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Vgll1 Mouse Gene Knockout Kit (CRISPR)
KN318884 1 Kit

Vgll1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Mouse ACVRL1 Protein (His Tag)
PDMM100096-01 20 µg

Recombinant Mouse ACVRL1 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Mouse ACVRL1 Protein (His Tag)
PDMM100096-02 100 µg

Recombinant Mouse ACVRL1 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Mouse ACVRL1 Protein (His Tag)
PDMM100096-03 500 µg

Recombinant Mouse ACVRL1 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Mouse ACVRL1 Protein (His Tag)
PDMM100096-04 1 mg

Recombinant Mouse ACVRL1 Protein (His Tag)

Sign In for Pricing
View Details