Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

WDR83 Peptide - C-terminal region

WDR83 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MGC4238, MORG1

UniProt

Q9BRX9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with WDR83 Rabbit Polyclonal Antibody (orb584664) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_115708

Preservative

Lyophilized powder

AA Sequence

EGALALALPVGSGVVQSLAYHPTEPCLLTAMGGSVQCWREEAYEAEDGAG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MRG15 (MORF4L1) (NM_006791) Human Untagged Clone
SC115850 10 µg

MRG15 (MORF4L1) (NM_006791) Human Untagged Clone

Sign In for Pricing
View Details
COMMD10 Antibody, FITC conjugated
MBS7044888-01 0.05 mg

COMMD10 Antibody, FITC conjugated

Sign In for Pricing
View Details
COMMD10 Antibody, FITC conjugated
MBS7044888-02 0.1 mg

COMMD10 Antibody, FITC conjugated

Sign In for Pricing
View Details
COMMD10 Antibody, FITC conjugated
MBS7044888-03 5x 0.1 mg

COMMD10 Antibody, FITC conjugated

Sign In for Pricing
View Details
CspA Antibody
CSB-PA748537XA01SUL-01 50 μL

CspA Antibody

Sign In for Pricing
View Details
CspA Antibody
CSB-PA748537XA01SUL-02 100 µL

CspA Antibody

Sign In for Pricing
View Details