Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

WDR87 Peptide - C-terminal region

WDR87 Peptide - C-terminal region

Product Specifications

Product Name Alternative

FLJ52608, NYD-SP11

UniProt

Q6ZQQ6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with WDR87 Rabbit Polyclonal Antibody (orb326355) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

BAC87627

Preservative

Lyophilized powder

AA Sequence

PQRELEWDRSQEFFFWHSRVRAISNTEYPKNKEEDEHFLEMRLSKDVTYS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human a-Soluble NSF Attachment Protein/SNAP-a/NAPA (N-6His)
32-7253-10 10 µg

Recombinant Human a-Soluble NSF Attachment Protein/SNAP-a/NAPA (N-6His)

Sign In for Pricing
View Details
Bovine Zaire Ebola Virus IgM (ZEBOV-IgM) ELISA Kit
OM624757 96 Strip Well

Bovine Zaire Ebola Virus IgM (ZEBOV-IgM) ELISA Kit

Sign In for Pricing
View Details
Pectinase Polyclonal Antibody, AbBy Fluor™ 405 Conjugated
bs-4550R-BF405 100 µL

Pectinase Polyclonal Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details
Recombinant Klebsiella pneumoniae subsp. pneumoniae Sulfate adenylyltransferase subunit 2 (cysD)
MBS1248853-01 0.02 mg (E-Coli)

Recombinant Klebsiella pneumoniae subsp. pneumoniae Sulfate adenylyltransferase subunit 2 (cysD)

Sign In for Pricing
View Details
Recombinant Klebsiella pneumoniae subsp. pneumoniae Sulfate adenylyltransferase subunit 2 (cysD)
MBS1248853-02 0.02 mg (Yeast)

Recombinant Klebsiella pneumoniae subsp. pneumoniae Sulfate adenylyltransferase subunit 2 (cysD)

Sign In for Pricing
View Details
Recombinant Klebsiella pneumoniae subsp. pneumoniae Sulfate adenylyltransferase subunit 2 (cysD)
MBS1248853-03 0.1 mg (E-Coli)

Recombinant Klebsiella pneumoniae subsp. pneumoniae Sulfate adenylyltransferase subunit 2 (cysD)

Sign In for Pricing
View Details