Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

WDR87 Peptide - C-terminal region

WDR87 Peptide - C-terminal region

Product Specifications

Product Name Alternative

FLJ52608, NYD-SP11

UniProt

Q6ZQQ6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with WDR87 Rabbit Polyclonal Antibody (orb326355) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

BAC87627

Preservative

Lyophilized powder

AA Sequence

PQRELEWDRSQEFFFWHSRVRAISNTEYPKNKEEDEHFLEMRLSKDVTYS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

pLV3×FLAG-CopGFP-Puro Plasmid
PVT58897 2 µg

pLV3×FLAG-CopGFP-Puro Plasmid

Sign In for Pricing
View Details
Lentiviral human TARP shRNA (UAS) - Lentiviral human TARP shRNA (UAS, GFP) plasmid
GTR15331213 1 Vial

Lentiviral human TARP shRNA (UAS) - Lentiviral human TARP shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
Plain Desiccator, PP, Plate Diameter 200 mm - ABDOS
E11602 1 Unit/Pack

Plain Desiccator, PP, Plate Diameter 200 mm - ABDOS

Sign In for Pricing
View Details
Recombinant Rat Tryptase (TPS)
RPU44200-01 50 µg

Recombinant Rat Tryptase (TPS)

Sign In for Pricing
View Details
Recombinant Rat Tryptase (TPS)
RPU44200-02 100 µg

Recombinant Rat Tryptase (TPS)

Sign In for Pricing
View Details
Recombinant Rat Tryptase (TPS)
RPU44200-03 1 mg

Recombinant Rat Tryptase (TPS)

Sign In for Pricing
View Details