Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

WFDC1 Peptide - middle region

WFDC1 Peptide - middle region

Product Specifications

Product Name Alternative

PS20

UniProt

Q9HC57

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with WFDC1 Rabbit Polyclonal Antibody (orb330928) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_067020

Preservative

Lyophilized powder

AA Sequence

VAEGIPNRGQCVKQRRQADGRILRHKLYKEYPEGDSKNVAEPGRGQQKHF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Trypsin (MaxLight 490)
T8669-12-ML490 100 µL

Trypsin (MaxLight 490)

Sign In for Pricing
View Details
Anti-SAE2/UBA2 Antibody Picoband® (Biotine Conjugate)
A03816-2-Biotin 100 µg/Vial

Anti-SAE2/UBA2 Antibody Picoband® (Biotine Conjugate)

Sign In for Pricing
View Details
HD (Huntingtin, HD, IT15) (MaxLight 405)
MBS6195894-01 0.1 mL

HD (Huntingtin, HD, IT15) (MaxLight 405)

Sign In for Pricing
View Details
HD (Huntingtin, HD, IT15) (MaxLight 405)
MBS6195894-02 5x 0.1 mL

HD (Huntingtin, HD, IT15) (MaxLight 405)

Sign In for Pricing
View Details
Lrrc57 siRNA Oligos set (Rat)
27687176 3x 5 nmol

Lrrc57 siRNA Oligos set (Rat)

Sign In for Pricing
View Details
Recombinant Rat Pdcd1lg2 Protein, His-tagged, FITC conjugated
Pdcd1lg2-542RF 20 μg- 50 μg- 100 μg

Recombinant Rat Pdcd1lg2 Protein, His-tagged, FITC conjugated

Sign In for Pricing
View Details