WFDC1 Peptide - middle region
WFDC1 Peptide - middle region
Product Specifications
Product Name Alternative
PS20
UniProt
Q9HC57
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with WFDC1 Rabbit Polyclonal Antibody (orb330928) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_067020
Preservative
Lyophilized powder
AA Sequence
VAEGIPNRGQCVKQRRQADGRILRHKLYKEYPEGDSKNVAEPGRGQQKHF
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
VAng-Ly2654-50gEcoli 50 µg (E. coli)
Recombinant Campylobacter Jejuni glyA Protein (aa 1-414) (strain RM1221)
Sign In for Pricing
View Details MBS6004371-01 0.05 mL
Oct4 (POU Domain, Class 5, Transcription Factor 1, Octamer-binding Protein 3, Oct-3, Octamer-binding Protein 4, Oct-4, Octamer-binding Transcription Factor 3, OTF-3, POU5F1, OCT3, OTF3)
Sign In for Pricing
View Details MBS6004371-02 5x 0.05 mL
Oct4 (POU Domain, Class 5, Transcription Factor 1, Octamer-binding Protein 3, Oct-3, Octamer-binding Protein 4, Oct-4, Octamer-binding Transcription Factor 3, OTF-3, POU5F1, OCT3, OTF3)
Sign In for Pricing
View Details MP-414-C57 10 Slides
Mouse C57 Mammary Gland Paraffin Sections, Non-Pregnant
Sign In for Pricing
View Details