Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Wnt3a Peptide - C-terminal region

Wnt3a Peptide - C-terminal region

Product Specifications

Product Name Alternative

Vt, Wnt-3a

UniProt

P27467

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Wnt3a Rabbit Polyclonal Antibody (orb584128) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

IHC, WB

NCBI Accession Number

NP_033548

Preservative

Lyophilized powder

AA Sequence

IGDFLKDKYDSASEMVVEKHRESRGWVETLRPRYTYFKVPTERDLVYYEA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat IFN-gamma ELISA Kit (48-well)
EA100161 48 Well

Rat IFN-gamma ELISA Kit (48-well)

Sign In for Pricing
View Details
Neomycin Trisulfate Hydrate
TRC-N389975-100G 100 g

Neomycin Trisulfate Hydrate

Sign In for Pricing
View Details
C20orf27 (NM_001039140) Human Over-expression Lysate
LC422021 20 µg

C20orf27 (NM_001039140) Human Over-expression Lysate

Sign In for Pricing
View Details
EGLN1 / PHD2 (366G/76/3), CF647 conjugate, 0.1mg/mL
BNC473074-100 1x 100 µL

EGLN1 / PHD2 (366G/76/3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Immobilized Polyporus squamosus Lectin (mushroom) -PSL
A-9006-1 1 mL

Immobilized Polyporus squamosus Lectin (mushroom) -PSL

Sign In for Pricing
View Details
Recombinant Human CD74 protein (His Tag)
PDEH100704-01 20 µg

Recombinant Human CD74 protein (His Tag)

Sign In for Pricing
View Details