Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Wnt3a Peptide - C-terminal region

Wnt3a Peptide - C-terminal region

Product Specifications

Product Name Alternative

Vt, Wnt-3a

UniProt

P27467

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Wnt3a Rabbit Polyclonal Antibody (orb584128) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

IHC, WB

NCBI Accession Number

NP_033548

Preservative

Lyophilized powder

AA Sequence

IGDFLKDKYDSASEMVVEKHRESRGWVETLRPRYTYFKVPTERDLVYYEA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MCM7 (Proliferation Marker) (MCM7/2832R), CF640R conjugate, 0.1mg/mL
BNC402832-100 1x 100 µL

MCM7 (Proliferation Marker) (MCM7/2832R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human CCL20, Tag Free
HA211012-01 Inquire

Human CCL20, Tag Free

Sign In for Pricing
View Details
Human CCL20, Tag Free
HA211012-02 50 µg

Human CCL20, Tag Free

Sign In for Pricing
View Details
Human CCL20, Tag Free
HA211012-03 100 µg

Human CCL20, Tag Free

Sign In for Pricing
View Details
CD68 (Macrophage Marker) (C68/2709), CF405S conjugate, 0.1mg/mL
BNC042709-100 1x 100 µL

CD68 (Macrophage Marker) (C68/2709), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IGF1 Receptor (IGF1R) Mouse Monoclonal Antibody [Clone ID: OTI4C4]
CF807835 100 µg

IGF1 Receptor (IGF1R) Mouse Monoclonal Antibody [Clone ID: OTI4C4]

Sign In for Pricing
View Details