Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

WNT8B Peptide - N-terminal region

WNT8B Peptide - N-terminal region

Product Specifications

UniProt

Q93098

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with WNT8B Rabbit Polyclonal Antibody (orb583867) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003384

Preservative

Lyophilized powder

AA Sequence

QLSSHGGLRSANRETAFVHAISSAGVMYTLTRNCSLGDFDNCGCDDSRNG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human TRAP-alpha/SSR1 Protein (Fc Tag)
PKSH030538 100 µg

Recombinant Human TRAP-alpha/SSR1 Protein (Fc Tag)

Sign In for Pricing
View Details
RAD51 (Ab-309) Antibody
8B8410-AAT 50 µg

RAD51 (Ab-309) Antibody

Sign In for Pricing
View Details
Octanohydroxamic Acid
TRC-O109220-500MG 500 mg

Octanohydroxamic Acid

Sign In for Pricing
View Details
P21WAF1 (Tumor Suppressor Protein) (rCIP1/823), CF640R conjugate, 0.1mg/mL
BNC402292-100 1x 100 µL

P21WAF1 (Tumor Suppressor Protein) (rCIP1/823), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MIR4448 Human qPCR Primer Pair (MI0016791)
HP300965 200 Reactions

MIR4448 Human qPCR Primer Pair (MI0016791)

Sign In for Pricing
View Details
G protein alpha S (GNAS) (NM_001077489) Human Over-expression Lysate
LC421440 20 µg

G protein alpha S (GNAS) (NM_001077489) Human Over-expression Lysate

Sign In for Pricing
View Details