Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

WNT8B Peptide - N-terminal region

WNT8B Peptide - N-terminal region

Product Specifications

UniProt

Q93098

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with WNT8B Rabbit Polyclonal Antibody (orb583867) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003384

Preservative

Lyophilized powder

AA Sequence

QLSSHGGLRSANRETAFVHAISSAGVMYTLTRNCSLGDFDNCGCDDSRNG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human TIMM10 activation kit by CRISPRa
GA108886 1 Kit

Human TIMM10 activation kit by CRISPRa

Sign In for Pricing
View Details
CA6 Antibody
8C14943-AAT 50 µg

CA6 Antibody

Sign In for Pricing
View Details
SHARP1 (BHLHE41) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5B1]
TA806394AM 100 µL

SHARP1 (BHLHE41) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5B1]

Sign In for Pricing
View Details
BMP4 Polyclonal Antibody
E-AB-90016-01 60 µL

BMP4 Polyclonal Antibody

Sign In for Pricing
View Details
BMP4 Polyclonal Antibody
E-AB-90016-02 120 µL

BMP4 Polyclonal Antibody

Sign In for Pricing
View Details
BMP4 Polyclonal Antibody
E-AB-90016-03 200 µL

BMP4 Polyclonal Antibody

Sign In for Pricing
View Details