Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Xpnpep2 Peptide - C-terminal region

Xpnpep2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

9030008G12Rik, mAPP

UniProt

B1AVD1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Xpnpep2 Rabbit Polyclonal Antibody (orb578103) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_573476

Preservative

Lyophilized powder

AA Sequence

LIDVRLLSPEQLQYLNRYYQTIRENVGPELQRRQLLEEFAWLEQHTEPLS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VAX1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1E7]
TA811403AM 100 µL

VAX1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1E7]

Sign In for Pricing
View Details
RPL23AP43 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
LV778529 1.0 µg DNA

RPL23AP43 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
XLF (NHEJ1) Mouse Monoclonal Antibody [Clone ID: LBI1E2]
AMM10661VCF 100 µg

XLF (NHEJ1) Mouse Monoclonal Antibody [Clone ID: LBI1E2]

Sign In for Pricing
View Details
SUPER-X PLEX ® Non-Human Primate IL-8 Flow Cytometry Assay - Group 1
PX80021 96 Tests

SUPER-X PLEX ® Non-Human Primate IL-8 Flow Cytometry Assay - Group 1

Sign In for Pricing
View Details
pOTB7-VPS51 Plasmid
PVT28621 2 µg

pOTB7-VPS51 Plasmid

Sign In for Pricing
View Details
PAK4 (NM_005884) Human Tagged ORF Clone Lentiviral Particle
RC202302L2V 200 µL

PAK4 (NM_005884) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details