Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Xpnpep2 Peptide - C-terminal region

Xpnpep2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

9030008G12Rik, mAPP

UniProt

B1AVD1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Xpnpep2 Rabbit Polyclonal Antibody (orb578103) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_573476

Preservative

Lyophilized powder

AA Sequence

LIDVRLLSPEQLQYLNRYYQTIRENVGPELQRRQLLEEFAWLEQHTEPLS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C-Myb Polyclonal Antibody
E041806 100 µg -100 µL

C-Myb Polyclonal Antibody

Sign In for Pricing
View Details
Integrin αV Rabbit mAb
E60M1014 100 µL

Integrin αV Rabbit mAb

Sign In for Pricing
View Details
Cat Protein Phosphatase 1 Regulatory Subunit 12B (PPP1R12B) ELISA Kit
MBS9916174 Inquire

Cat Protein Phosphatase 1 Regulatory Subunit 12B (PPP1R12B) ELISA Kit

Sign In for Pricing
View Details
PPRC1 (NM_001288728) Human Tagged ORF Clone
RC240175 10 µg

PPRC1 (NM_001288728) Human Tagged ORF Clone

Sign In for Pricing
View Details
TINF2 (TERF1-interacting Nuclear Factor 2, TRF1-interacting Nuclear Protein 2, TIN2, DKCA3) (AP)
MBS6134209-01 0.1 mL

TINF2 (TERF1-interacting Nuclear Factor 2, TRF1-interacting Nuclear Protein 2, TIN2, DKCA3) (AP)

Sign In for Pricing
View Details
TINF2 (TERF1-interacting Nuclear Factor 2, TRF1-interacting Nuclear Protein 2, TIN2, DKCA3) (AP)
MBS6134209-02 5x 0.1 mL

TINF2 (TERF1-interacting Nuclear Factor 2, TRF1-interacting Nuclear Protein 2, TIN2, DKCA3) (AP)

Sign In for Pricing
View Details