Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Xpo5 Peptide - N-terminal region

Xpo5 Peptide - N-terminal region

Product Specifications

Product Name Alternative

Exp5, RanBp21

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Xpo5 Rabbit Polyclonal Antibody (orb580158) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001102259

Preservative

Lyophilized powder

AA Sequence

LNFLLSTLQENVNKYQQMKTDASQEAEAQANCRVSIAALNTLAGYIDWVS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dowtherm A
TRC-D537100-50ML 50 mL

Dowtherm A

Sign In for Pricing
View Details
Recombinant Human NRN1L Protein (His Tag)
PKSH032795-01 10 µg

Recombinant Human NRN1L Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human NRN1L Protein (His Tag)
PKSH032795-02 50 µg

Recombinant Human NRN1L Protein (His Tag)

Sign In for Pricing
View Details
PIGG (NM_001289053) Human Tagged ORF Clone
RG238480 10 µg

PIGG (NM_001289053) Human Tagged ORF Clone

Sign In for Pricing
View Details
3-Amino-1,2-propandiol
TRC-A628110-50G 50 g

3-Amino-1,2-propandiol

Sign In for Pricing
View Details
Human ARIH2 activation kit by CRISPRa
GA107108 1 Kit

Human ARIH2 activation kit by CRISPRa

Sign In for Pricing
View Details