Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Xpo5 Peptide - N-terminal region

Xpo5 Peptide - N-terminal region

Product Specifications

Product Name Alternative

Exp5, RanBp21

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Xpo5 Rabbit Polyclonal Antibody (orb580158) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001102259

Preservative

Lyophilized powder

AA Sequence

LNFLLSTLQENVNKYQQMKTDASQEAEAQANCRVSIAALNTLAGYIDWVS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZKSCAN5 (NM_145102) Human Over-expression Lysate
LY403424 100 µg

ZKSCAN5 (NM_145102) Human Over-expression Lysate

Sign In for Pricing
View Details
Tissue Total RNA, Colon
CR559476 5 µg

Tissue Total RNA, Colon

Sign In for Pricing
View Details
Phospho C-Jun (Thr91, Thr93) (C-J 4C4/1), CF488A conjugate, 0.1mg/mL
BNC882282-100 1x 100 µL

Phospho C-Jun (Thr91, Thr93) (C-J 4C4/1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
1,4’-Bipiperidine
TRC-B398960-25G 25 g

1,4’-Bipiperidine

Sign In for Pricing
View Details
Recombinant Mouse CAMK4/CaMKIV Protein
PKSM040459 50 µg

Recombinant Mouse CAMK4/CaMKIV Protein

Sign In for Pricing
View Details
CBWD1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2D2]
TA501687AM 100 µL

CBWD1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2D2]

Sign In for Pricing
View Details