Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

XRCC3 Peptide - middle region

XRCC3 Peptide - middle region

Product Specifications

Product Name Alternative

CMM6

UniProt

O43542

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with XRCC3 Rabbit Polyclonal Antibody (orb584961) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005423

Preservative

Lyophilized powder

AA Sequence

LAVQFPRQHGGLEAGAVYICTEDAFPHKRLQQLMAQQPRLRTDVPGELLQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRTFDC1 Antibody / Phosphoribosyltransferase domain-containing protein 1
RQ8102 100 µg

PRTFDC1 Antibody / Phosphoribosyltransferase domain-containing protein 1

Sign In for Pricing
View Details
PLEK Blocking Peptide
33R-5943 0.1 mg

PLEK Blocking Peptide

Sign In for Pricing
View Details
TMEM30B (NM_001017970) Human Over-expression Lysate
LS161291 100 µg

TMEM30B (NM_001017970) Human Over-expression Lysate

Sign In for Pricing
View Details
Lrit2-set siRNA/shRNA/RNAi Lentivector (Mouse)
27599094 4x 500 ng

Lrit2-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing
View Details
Armcx1 3'UTR Lenti-reporter-Luc Vector
12419086 1.0 µg

Armcx1 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Human anillin, actin binding protein (ANLN) control (ANLN- phosphor) peptide
AB-23011-P 100 µg

Human anillin, actin binding protein (ANLN) control (ANLN- phosphor) peptide

Sign In for Pricing
View Details