Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ywhae Peptide - C-terminal region

Ywhae Peptide - C-terminal region

Product Specifications

Product Name Alternative

AU019196

UniProt

P62259

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Ywhae Rabbit Polyclonal Antibody (orb574042) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

IHC, WB

NCBI Accession Number

NP_033562

Preservative

Lyophilized powder

AA Sequence

ELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQGDGEEQNKEALQDVEDEN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

WDR79 (WRAP53) (NM_018081) Human Recombinant Protein
TP300142 20 µg

WDR79 (WRAP53) (NM_018081) Human Recombinant Protein

Sign In for Pricing
View Details
Mcam-set siRNA/shRNA/RNAi Lentivector (Rat)
28197096 4x 500 ng

Mcam-set siRNA/shRNA/RNAi Lentivector (Rat)

Sign In for Pricing
View Details
Sox7 Mouse siRNA Oligo Duplex (Locus ID 20680)
SR412816 1 Kit

Sox7 Mouse siRNA Oligo Duplex (Locus ID 20680)

Sign In for Pricing
View Details
Prefoldin 3 (D-5) Alexa Fluor® 790
sc-390524 AF790 200 µg/mL

Prefoldin 3 (D-5) Alexa Fluor® 790

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Cytokeratin 19 (CK19)
MBS2165309-01 0.1 mL

APC-Linked Polyclonal Antibody to Cytokeratin 19 (CK19)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Cytokeratin 19 (CK19)
MBS2165309-02 0.2 mL

APC-Linked Polyclonal Antibody to Cytokeratin 19 (CK19)

Sign In for Pricing
View Details