Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

YY1AP1 Peptide - middle region

YY1AP1 Peptide - middle region

Product Specifications

Product Name Alternative

FLJ10875, FLJ13914, HCCA1, HCCA2, YAP, YY1AP

UniProt

D3DV96

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with YY1AP1 Rabbit Polyclonal Antibody (orb581210) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_620830

Preservative

Lyophilized powder

AA Sequence

WTVVKTEEGRQALEPLPQGIQESLNNSSPGDLEEVVKMEPEDATEEISGF

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCDC87 (NM_018219) Human 3' UTR Clone
SC203879 10 µg

CCDC87 (NM_018219) Human 3' UTR Clone

Sign In for Pricing
View Details
AXL Blocking Peptide
abx061788-01 1 mg

AXL Blocking Peptide

Sign In for Pricing
View Details
AXL Blocking Peptide
abx061788-02 5 mg

AXL Blocking Peptide

Sign In for Pricing
View Details
HDAC3 siRNA (m)
sc-35539 10 µM

HDAC3 siRNA (m)

Sign In for Pricing
View Details
Rat Casein kinase II subunit Alpha (CSNK2A1) ELISA kit
GTR10451955 96 Well

Rat Casein kinase II subunit Alpha (CSNK2A1) ELISA kit

Sign In for Pricing
View Details
GPR17 shRNA Plasmid (m)
sc-76031-SH 20 µg

GPR17 shRNA Plasmid (m)

Sign In for Pricing
View Details