YY1AP1 Peptide - middle region
YY1AP1 Peptide - middle region
Product Specifications
Product Name Alternative
FLJ10875, FLJ13914, HCCA1, HCCA2, YAP, YY1AP
UniProt
D3DV96
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with YY1AP1 Rabbit Polyclonal Antibody (orb581210) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_620830
Preservative
Lyophilized powder
AA Sequence
WTVVKTEEGRQALEPLPQGIQESLNNSSPGDLEEVVKMEPEDATEEISGF
More Discoveries
Explore Other Products
Browse additional items from our catalog
132712-ML750 100 µL
RNPEP (APB, Aminopeptidase B, Arginine Aminopeptidase, Arginyl Aminopeptidase) (MaxLight 750) discontinued
Sign In for Pricing
View Details 
MBS6434146-01 0.1 mL
PTPN11 (Protein Tyrosine Phosphatase Non-receptor Type 11, Noonan Syndrome 1, Protein Tyrosine Phosphatase 2C, BPTP3, CFC, MGC14433, NS1, PTP-1D, PTP2C, SH-PTP2, SH-PTP3, SHP2) (MaxLight 405)
Sign In for Pricing
View Details MBS6434146-02 5x 0.1 mL
PTPN11 (Protein Tyrosine Phosphatase Non-receptor Type 11, Noonan Syndrome 1, Protein Tyrosine Phosphatase 2C, BPTP3, CFC, MGC14433, NS1, PTP-1D, PTP2C, SH-PTP2, SH-PTP3, SHP2) (MaxLight 405)
Sign In for Pricing
View Details