Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZBTB4 Peptide - C-terminal region

ZBTB4 Peptide - C-terminal region

Product Specifications

Product Name Alternative

KAISO-L1, KIAA1538, ZNF903

UniProt

Q9P1Z0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZBTB4 Rabbit Polyclonal Antibody (orb577124) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_065950

Preservative

Lyophilized powder

AA Sequence

PFLPGVFGYAVNPQAAPPAPPTPPPPTLPPPIPPKGEGERAGVERTQKGD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ferritin Heavy Chain (FTH1) (C-term) Rabbit Polyclonal Antibody
AP17403PU-N 400 µL

Ferritin Heavy Chain (FTH1) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Cacnb3 activation kit by CRISPRa
GA200485 1 Kit

Mouse Cacnb3 activation kit by CRISPRa

Sign In for Pricing
View Details
RPL18AP3 Human qPCR Primer Pair (NR_001593)
HP219964 200 Reactions

RPL18AP3 Human qPCR Primer Pair (NR_001593)

Sign In for Pricing
View Details
8,9-Epoxy-moxidectin (>90%)
TRC-E589248-5MG 5 mg

8,9-Epoxy-moxidectin (>90%)

Sign In for Pricing
View Details
Prostate Specific Acid Phosphatase (PSAP) (rACPP/1338), CF405S conjugate, 0.1mg/mL
BNC042074-500 1x 500 µL

Prostate Specific Acid Phosphatase (PSAP) (rACPP/1338), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
rac-2-Palmitoyl-1-oleoyl-3-chloropropanediol-d5
TRC-P160517-10MG 10 mg

rac-2-Palmitoyl-1-oleoyl-3-chloropropanediol-d5

Sign In for Pricing
View Details