Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZBTB46 Peptide - middle region

ZBTB46 Peptide - middle region

Product Specifications

Product Name Alternative

BTBD4, FLJ13502, RINZF, ZNF340, dJ583P15.7, dJ583P15.8

UniProt

Q6ZMU8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZBTB46 Rabbit Polyclonal Antibody (orb581178) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_079500

Preservative

Lyophilized powder

AA Sequence

DSSGDSAIASCHDGGSSYGKEDQEPKADGPDDVSSQPLWPGDVGYGPLRI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BAPTA AM - calcium chelator
1081U 25x 1 mg

BAPTA AM - calcium chelator

Sign In for Pricing
View Details
Milk Fat Globulin (EDM45), 1mg/mL
BNUM0942-50 1x 50 µL

Milk Fat Globulin (EDM45), 1mg/mL

Sign In for Pricing
View Details
Biglycan (BGN) Human Gene Knockout Kit (CRISPR)
KN400715 1 Kit

Biglycan (BGN) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TentaGel® MB RAM
MB160230.50G 50 g

TentaGel® MB RAM

Sign In for Pricing
View Details
Human RNF12 (RLIM) activation kit by CRISPRa
GA109594 1 Kit

Human RNF12 (RLIM) activation kit by CRISPRa

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS710060 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details