Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZBTB46 Peptide - middle region

ZBTB46 Peptide - middle region

Product Specifications

Product Name Alternative

BTBD4, FLJ13502, RINZF, ZNF340, dJ583P15.7, dJ583P15.8

UniProt

Q6ZMU8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZBTB46 Rabbit Polyclonal Antibody (orb581178) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_079500

Preservative

Lyophilized powder

AA Sequence

DSSGDSAIASCHDGGSSYGKEDQEPKADGPDDVSSQPLWPGDVGYGPLRI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Acid Green 3 (~50%)
TRC-A189865-2.5G 2.5 g

Acid Green 3 (~50%)

Sign In for Pricing
View Details
LY75 (LY75-CD302) Rabbit Polyclonal Antibody
TA371109 100 µL

LY75 (LY75-CD302) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Cytokeratin 4 Recombinant Rabbit Monoclonal Antibody [SN74-03]
ET1611-71 100 µL

Cytokeratin 4 Recombinant Rabbit Monoclonal Antibody [SN74-03]

Sign In for Pricing
View Details
NUP210L Human Gene Knockout Kit (CRISPR)
KN415583 1 Kit

NUP210L Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Human Placental Alkaline Phosphatase 1/ALPP Protein (His Tag)
PKSH032058-01 10 µg

Recombinant Human Placental Alkaline Phosphatase 1/ALPP Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human Placental Alkaline Phosphatase 1/ALPP Protein (His Tag)
PKSH032058-02 50 µg

Recombinant Human Placental Alkaline Phosphatase 1/ALPP Protein (His Tag)

Sign In for Pricing
View Details