Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZBTB8 Peptide - C-terminal region

ZBTB8 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ZNF916B, RP1-27O5.1, DKFZp547H154, ZBTB8B, BOZF1, FLJ90065, MGC17919

UniProt

Q8NAP8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZBTB8 Rabbit Polyclonal Antibody (orb573844) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001139192

Preservative

Lyophilized powder

AA Sequence

LSQGLRRFGLCDSCTCVTDTPDDDDDLMPINLSLVEASSESQEKSDTDND

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-(Diethylamino)ethyl 3-amino-4-(2-(diethylamino)ethoxy)benzoate Hydrochloride
TRC-D367020-10MG 10 mg

2-(Diethylamino)ethyl 3-amino-4-(2-(diethylamino)ethoxy)benzoate Hydrochloride

Sign In for Pricing
View Details
Zomepirac Sodium Salt Hydrate
TRC-Z675005-500MG 500 mg

Zomepirac Sodium Salt Hydrate

Sign In for Pricing
View Details
Tissue Total RNA, Myometrium
CR559276 5 µg

Tissue Total RNA, Myometrium

Sign In for Pricing
View Details
Ethylene Terephthalate Cyclic Hexamer
TRC-E918180-2.5MG 2.5 mg

Ethylene Terephthalate Cyclic Hexamer

Sign In for Pricing
View Details
CD14 (Monocyte / Macrophage Marker) (LPSR/2385), CF488A conjugate, 0.1mg/mL
BNC882385-500 1x 500 µL

CD14 (Monocyte / Macrophage Marker) (LPSR/2385), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
RAN (NM_006325) Human Recombinant Protein
TP308738 20 µg

RAN (NM_006325) Human Recombinant Protein

Sign In for Pricing
View Details